PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000513G0530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 402aa    MW: 43195.8 Da    PI: 8.2234
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000513G0530genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.26.1e-23308348141
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrk 41 
                      ++epgrCrRtDGKkWRC r+v++++k+CErH+hrgr+r  +
  PH01000513G0530 308 EPEPGRCRRTDGKKWRCHRNVIPNEKYCERHMHRGRKRPVQ 348
                      69***********************************9876 PP

2QLQ47.65e-17242277237
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      aF+ +Qlq+L+ Q l+++y+aa+ PvP +L+++i+k
  PH01000513G0530 242 AFNMMQLQELEEQSLVFQYMAARIPVPTHLVFPIWK 277
                      8*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.9E-7241277IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.914242277IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.1E-10242276IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.724308352IPR014977WRC domain
PfamPF088791.0E-19309346IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MVNLDTLVHH VDLAAEKINV VAYSEGPLDL ILGPHDPCDT EHVMAAEAEN LLATTDMEQV  60
MAAEAQNLFA IEKTEEQTSK GPDVPILRRS SRLVERSGGR YENVVRKAME RKAHCRNDVE  120
LLSALLGRSC SRSENPRSRL GRGGEERNGG KYDNVVRKAL VSKAHCRDAR DLARGVSRVG  180
GIFGPPAMEG SGLAAASRGA EAAGGNTPAA SSGTVPGVAP TTEVQEEMGT LVASIPVGAG  240
AAFNMMQLQE LEEQSLVFQY MAARIPVPTH LVFPIWKSVT GASSEGAQKY PTLMGLATHC  300
LDFGKNPEPE PGRCRRTDGK KWRCHRNVIP NEKYCERHMH RGRKRPVQLA VKDDELDSAS  360
WSKSASGKAT FKATEGGKKT DDKSSSSKKL AVEASAAVQS T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67353152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-29growth-regulating factor 5